TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P54933|SMOK_RHOSH ATP-binding transport protein smoK (PolK) - Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides).
MGKITLRNVQKRFGEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQIMIDGRDATEMPPAKRGLAMV
FQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAKILNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEP
LSNLDAALRVNMRLEITELHQSLETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIGSPKMN
LIEGPEAAKHGATTIGIRPEHIDLSREAGAWEGEVGVSEHLGSDTFLHVHVAGMPTLTVRTGGEFGVHHGDRVWLTPQAD
KIHRFGADGKAL