TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P55712|NOLW_RHISN NODULATION PROTEIN NOLW - Rhizobium sp. (strain NGR234).
MPTTPIPFTPLHMFRRLLCVGLFLFAGIHTTLGATLPLPSTSYKYTVLDQDLSAALQEFGNNLKISVNISAEVKGRIRGR
IPELSPREFLDRLTDLYDLQWYYDGVVLYVSAAKEAQTRMLVLSSVHFSAFKLALDKLDISDERYPVRPAPGNGLVLVSG
PPRFMALIEQTLNGLLAVAQAQPRATDTPARESVMVLFRGSSTTVVRGGRPEVFYTSEMLPENDDGGKAELSKK