TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P58300|MALE_PYRFU Maltotriose-binding protein precursor (Maltodextrin-binding protein) (MMBP) - Pyrococcus furiosus.
MRRATYAFALLAILVLGVVASGCIGGGTTTPTQTSPATQPTTTQTPTQTETQAVECGSGKVVIWHAMQPNELEVFQSLAE
EYMALCPEVEIVFEQKPNLEDALKAAIPTGQGPDLFIWAHDWIGKFAEAGLLEPIDEYVTEDLLNEFAPMAQDAMQYKGH
YYALPFAAETVAIIYNKEMVSEPPKTFDEMKAIMEKYYDPANEKYGIAWPINAYFISAIAQAFGGYYFDDKTEQPGLDKP
ETIEGFKFFFTEIWPYMAPTGDYNTQQSIFLEGRAPMMVNGPWSINDVKKAGINFGVVPLPPIIKDGKEYWPRPYGGVKL
IYFAAGIKNKDAAWKFAKWLTTSEESIKTLALELGYIPVLTKVLDDPEIKNDPVIYGFGQAVQHAYLMPKSPKMSAVWGG
VDGAINEILQDPQNADIEGILKKYQQEILNNMQG