TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P59646|FXYD4_HUMAN FXYD domain-containing ion transport regulator 4 OS=Homo sapiens OX=9606 GN=FXYD4 PE=3 SV=2
MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPL
ITPGSATTC