TCDB is operated by the Saier Lab Bioinformatics Group
>P63115|AAA1_MOUSE Asc-type amino acid transporter 1 - Mus musculus (Mouse).
MRRDSDMASHIQQPGGHGNPGPAPSPSPGPGPGPGASERVALKKEIGLVSACTIIIGNIIGSGIFISPKGVLEHSGSVGL
ALFVWVLGGGVTALGSLCYAELGVAIPKSGGDYAYVTEIFGGLAGFLLLWSAVLIMYPTSLAVISMTFSNYVLQPVFPNC
IPPATASRVLSMACLMLLTWVNSSSVRWATRIQVIFTGGKLLALSLIITVGFVQIFQGHFEELRPTNAFAFWMTPSVGHL
ALAFLQGSFAFSGWNFLNYVTEELVDPRKNLPRAIFISIPLVTFVYTFTNVAYFTAMSPQELLSSNAVAVTFGEKLLGYF
SWVMPVSVALSTFGGINGYLFTSSRLCFSGAREGHLPSFLAMIHVRRCTPIPALLVCCGATAVIMLVGDTYTLINYVSFI
NYLCYGVTILGLLVLRWRRPALHRPIKVNLLVPVVYLVFWAFLLVFSFISEPMVCGVGIIIILTGVPIFFLGVFWRSKPK
CVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ