TCDB is operated by the Saier Lab Bioinformatics Group
>P65370|MMPL7_MYCTU Putative membrane protein mmpL7 - Mycobacterium tuberculosis.
MPSPAGRLHRIRYIRLKKSSPDCRATITSGSADGQRRSPRLTNLLVVAAWVAAAVIANLLLTFTQAEPHDTSPALLPQDA
KTAAATSRIAQAFPGTGSNAIAYLVVEGGSTLEPQDQPYYDAAVGALRADTRHVGSVLDWWSDPVTAPLGTSPDGRSATA
MVWLRGEAGTTQAAESLDAVRSVLRQLPPSEGLRASIVVPAITNDMPMQITAWQSATIVTVAAVIAVLLLLRARLSVRAA
AIVLLTADLSLAVAWPLAAVVRGHDWGTDSVFSWTLAAVLTIGTITAATMLAARLGSDAGHSAAPTYRDSLPAFALPGAC
VAIFTGPLLLARTPALHGVGTAGLGVFVALAASLTVLPALIALAGASRQLPAPTTGAGWTGRLSLPVSSASALGTAAVLA
ICMLPIIGMRWGVAENPTRQGGAQVLPGNALPDVVVIKSARDLRDPAALIAINQVSHRLVEVPGVRKVESAAWPAGVPWT
DASLSSAAGRLADQLGQQAGSFVPAVTAIKSMKSIIEQMSGAVDQLDSTVNVTLAGARQAQQYLDPMLAAARNLKNKTTE
LSEYLETIHTWIVGFTNCPDDVLCTAMRKVIEPYDIVVTGMNELSTGADRISAISTQTMSALSSAPRMVAQMRSALAQVR
SFVPKLETTIQDAMPQIAQASAMLKNLSADFADTGEGGFHLSRKDLADPSYRHVRESMFSSDGTATRLFLYSDGQLDLAA
AARAQQLEIAAGKAMKYGSLVDSQVTVGGAAQIAAAVRDALIHDAVLLAVILLTVVALASMWRGAVHGAAVGVGVLASYL
AALGVSIALWQHLLDRELNALVPLVSFAVLASCGVPYLVAGIKAGRIADEATGARSKGAVSGRGAVAPLAALGGVFGAGL
VLVSGGSFSVLSQIGTVVVLGLGVLITVQRAWLPTTPGRR