TCDB is operated by the Saier Lab Bioinformatics Group
>P68579|SUNT_BACSU SPBc2 prophage-derived sublancin-168-processing and transport ATP- binding protein sunT - Bacillus subtilis.
MNKKKKYVHTKQFNSHDCGLACISSILKFHNLNYGIDFLLDLIGDKEGYSLRDLIVIFKKMGIKTRPLELQENKTFEALK
QIKLPCIALLEGEEYGHYITIYEIRNNYLLVSDPDKDKITKIKKEDFESKFTNFILEIDKESIPEKEKDQKKHSYFFKDI
LFRNKLIVFVILLTSLFVVGLAVAGSFYIKFLVDLIIPRSLRESLITITLIFISMVLIRCIFDFVRSYLIIKLSYKVDKE
MSNVYFNKVTKLPINFFENREDGEVISRFNDGIYIKDFFSANFVTAIIDIILILGLGVILYRTNNILFLTIILPILLLSC
LAILFFDHLKKKNQKLMEDKAKSTSLLINFLKNMTTVYSLNKTSFFLEKFHLTYDKQLNSTFSVAKAVISNEILKGLIQN
SFTIIILWVGTRQVLNDSMSLGTLLFINTLAAFLLSSLDRILSMQSDLQQAHVASIRFFDVVNYPVQQDSNENLTELDFI
QNIKTVNLNIGADPMRYIVEDINLILDRKDKVLIIGESGTGKSTFAKSLSKLYKVPDKSIYLNGLDINRYDHLSIRKRIV
YIDENPFLFKGTIKENLCMGEIFDQNEIENACIMSQCHEFICNLDKQYSYKLSENGSNLSTGQKQRLALARAILHQPQVL
ILDESLSNIDPDNTKLIYETLHRMDCLIILITHNDPSNFKYNKKLVFRNNRIIESSYSENKEYSI