TCDB is operated by the Saier Lab Bioinformatics Group
>tr|P72047|P72047_MYCTU Probable O-antigen/lipopolysaccharide transport ATP-binding protein ABC transporter RfbE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rfbE PE=1 SV=2
MSDPHHPHIQTHNAWVEFPIFDAKSRSLKKAVLGKAGGTIGRNNSNVVVIEALRDITMELNLGDRVGLVGHNGAGKSTLL
RLLSGIYEPTRGWAKVTGRVAPVFDLGIGMDPEISGYENIIIRGLFLGQTRKQMQAKVDEIAEFTELGEYLSMPLRTYST
GMRVRLAMGVVTSIDPEILLLDEGIGAVDADFLRKAQSRLQNLVERSGILVFASHSNEFLARLCKTAIWIDHGVIRLAGG
IEEVVRAYEGEDAARHVREVLAETQADRQNVQG