TCDB is operated by the Saier Lab Bioinformatics Group
>tr|P72049|P72049_MYCTU Probable O-antigen/lipopolysaccharide transport integral membrane protein ABC transporter RfbD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rfbD PE=1 SV=1
MTFMDAQASFQTQSRTLARVRGDLVDGFRRHELWLHLGWQDIKQRYRRSVLGPFWITIATGTTAVAMGGLYSKLFRLELS
EHLPYVTLGLIVWNLINAAILDGAEVFVANEGLIKQLPAPLSVHVYRLVWRQMIFFAHNIVIYFVIAIIFPKPWSWADLS
FLPALALIFLNCVWVSLCFGILATRYRDIGPLLFSVVQLLFFMTPIIWNDETLRRQGAGRWSSIVELNPLLHYLDIVRAP
LLGAHQELRHWLVVLVLTVVGWMLAAFAMRQYRARVPYWV