TCDB is operated by the Saier Lab Bioinformatics Group
>tr|P73797 Hypothetical protein slr1257 - Synechocystis sp. (strain PCC 6803).
MLILRRLILVVSLSFATIAIDITTRPGLEPVQGQGVETVDSQTLKVGVVGNPPFVFYGEGKNAAFTGISLDVWRAVAESQ
KWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAIEGITFTQPYFSSGIGLLIPGKPVSLWERFSPFFGIAALSS
AGVLTLLLFLVGNLIWLAEHRKNPEQFSPHYPEGVQNGMWFALVTLTTVGYGDRSPRTKLGQLVAGVWMLVALLSFSSIT
AGLASAFSTALSEASATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIY
YTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLGPGIEENQDLLPQNIGESPS