TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P75851|SSUC_ECOLI Putative aliphatic sulfonates transport permease protein SsuC OS=Escherichia coli (strain K12) GN=ssuC PE=1 SV=2
MATPVKKWLLRVAPWFLPVGIVAVWQLASSVGWLSTRILPSPEGVVTAFWTLSASGELWQHLAISSWRALIGFSIGGSLG
LILGLISGLSRWGERLLDTSIQMLRNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYINTWHGIRNIDRGLVEMARS
YGLSGIPLFIHVILPGALPSIMVGVRFALGLMWLTLIVAETISANSGIGYLAMNAREFLQTDVVVVAIILYALLGKLADV
SAQLLERLWLRWNPAYHLKEATV