TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P75962|YMFA_ECOLI Inner membrane protein ymfA OS=Escherichia coli (strain K12) GN=ymfA PE=1 SV=2
MSQDSKVFFRIFLGIGLVLILISVVVFYNQFTYSKDAIHTEGVIVDTVWHSSHSHRTGKDGSWYPVVAFRPTPDYTLIFN
SSIGSDFYEDSEGDKVNVYYSPGHPEKAEINNPWVNFFKWGFIGIMGVIFIAVGLLISMPSSKKSRRKRKSRP