TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P76269|YEBQ_ECOLI Hypothetical transport protein yebQ - Escherichia coli.
MPKVQADGLPLPQRYGAILTIVIGISMAVLDGAIANVALPTIATDLHATPASSIWVVNAYQIAIVISLLSFSFLGDMFGY
RRIYKCGLVVFLLSSLFCALSDSLQMLTLARVIQGFGGAALMSVNTALIRLIYPQRFLGRGMGINSFIVAVSSAAGPTIA
AAILSIASWKWLFLINVPLGIIALLLAMRFLPPNGSRASKPRFDLPSAVMNALTFGLLITALSGFAQGQSLTLIAAELVV
MVVVGIFFIRRQLSLPVPLLPVDLLRIPLFSLSICTSVCSFCAQMLAMVSLPFYLQTVLGRSEVETGLLLTPWPLATMVM
APLAGYLIERVHAGLLGALGLFIMAAGLFSLVLLPASPADINIIWPMILCGAGFGLFQSPNNHTIITSAPRERSGGASGM
LGTARLLGQSSGAALVALMLNQFGDNGTHVSLMAAAILAVIAACVSGLRITQPRSRA