TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P77214|CUSX_ECOLI Hypothetical protein cusX precursor - Escherichia coli.
MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTK
MSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ