TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P77228|YDFJ_ECOLI Putative inner membrane metabolite transport protein ydfJ OS=Escherichia coli (strain K12) GN=ydfJ PE=5 SV=1
MDFQLYSLGAALVFHEIFFPESSTAMALILAMGTYGAGYVARIVGAFIFGKMGDRIGRKKVLFITITMMGICTTLIGVLP
TYAQIGVFAPILLVTLRIIQGLGAGAEISGAGTMLAEYAPKGKRGIISSFVAMGTNCGTLSATAIWAFMFFILSKEELLA
WGWRIPFLASVVVMVFAIWLRMNLKESPVFEKVNDSNQPTAKPAPAGSMFQSKSFWLATGLRFGQAGNSGLIQTFLAGYL
VQTLLFNKAIPTDALMISSILGFMTIPFLGWLSDKIGRRIPYIIMNTSAIVLAWPMLSIIVDKSYAPSTIMVALIVIHNC
AVLGLFALENITMAEMFGCKNRFTRMAISKEIGGLIASGFGPILAGIFCTMTESWYPIAIMIMAYSVIGLISALKMPEVK
DRDLSALEDAAEDQPRVVRAAQPSRSL