TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P77237|ESSQ_ECOLI Lysis protein S homolog from lambdoid prophage Qin - Escherichia coli.
MKSMDKLTTGVAYGTSAGNAGFWALQLLDKVTPSQWAAIGVLGSLVFGLLTYLTNLYFKIKEDRRKAARGE