TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P77239|CUSB_ECOLI Putative copper efflux system protein cusB precursor - Escherichia coli.
MKKIALIIGSMIAGGIISAAGFTWVAKAEPPAEKTSTAERKILFWYDPMYPNTRFDKPGKSPFMDMDLVPKYADEESSAS
GVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVE
AQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQG
MDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTA
SEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
ESATHAH