TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P77726|YAJR_ECOLI Inner membrane transport protein YajR OS=Escherichia coli (strain K12) GN=yajR PE=1 SV=2
MNDYKMTPGERRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGASEALIGIAIGIYGLTQAVFQIPFGLLSDRIGRKPL
IVGGLAVFAAGSVIAALSDSIWGIILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIITH
KLGLHALFWMIAILATTGIALTIWVVPNSSTHVLNRESGMVKGSFSKVLAEPRLLKLNFGIMCLHILLMSTFVALPGQLA
DAGFPAAEHWKVYLATMLIAFGSVVPFIIYAEVKRKMKQVFVFCVGLIVVAEIVLWNAQTQFWQLVVGVQLFFVAFNLME
ALLPSLISKESPAGYKGTAMGVYSTSQFLGVAIGGSLGGWINGMFDGQGVFLAGAMLAAVWLTVASTMKEPPYVSSLRIE
IPANIAANEALKVRLLETEGIKEVLIAEEEHSAYVKIDSKVTNRFEIEQAIRQA