TCDB is operated by the Saier Lab Bioinformatics Group
>P82252|BAT1_RAT B(0,+)-type amino acid transporter 1 - Rattus norvegicus (Rat).
MEETSPRRRREDEKSVHSTEPKTTSLQKEVGLLSGICIIVGTIIGSGIFISPKSVLANTESVGPCLIIWAACGVLATLGA
LCFAELGTMITKSGGEYPYLMEAFGPIPAYLFSWTSLIVMKPSSFAIICLSFSEYVCAAFYLGCRPPAVVVKLLAAAAIL
LITTVNALSVRLGSYVQNVFTAAKLVIVAIIIISGLVLLAQGNVKNFQNSFEGSQTSVGSISLAFYNGLWAYDGWNQLNY
ITEELRNPYRNLPMAIVIGIPLVTVCYILMNIAYFTVMTPTELLQSQAVAVTFGDRVLYPASWVVPLFVAFSTIGAANGT
CFTAGRLIYVAGREGHMLKVLSYISVKRLTPAPALVFYGIIAIIYIIPGDINSLVNYFSFAAWLFYGMTILGLVVMRFTR
KDLERPIKVPIFIPIIVILVSVFLILAPIISSPAWEYLYCVLFILSGLIFYFLFVHYKFRWAQKISRPITKHLQMLMEVV
PPEKDPE