TCDB is operated by the Saier Lab Bioinformatics Group
>tr|P83698|P83698_BURPS Putative inward rectifier potassium channel protein - Burkholderia pseudomallei (Pseudomonas pseudomallei).
MNVDPFSPHSSDSFAQAASPARKPPRGGRRIWSGTREVIAYGMPASVWRDLYYWALKVSWPVFFASLAALFVVNNTLFAL
LYQLGDAPIANQSPPGFVGAFFFSVETLATVGYGDMHPQTVYAHAIATLEIFVGMSGIALSTGLVFARFARPRAKIMFAR
HAIVRPFNGRMTLMVRAANARQNVIAEARAKMRLMRREHSSEGYSLMKIHDLKLVRNEHPIFLLGWNMMHVIDESSPLFG
ETPESLAEGRAMLLVMIEGSDETTAQVMQARHAWEHDDIRWHHRYVDLMSDVDGMTHIDYTRFNDTEPVEPPGAAPDAQA
FAAKPGEGDARPV