TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P91682|SMO_DROME Protein smoothened OS=Drosophila melanogaster OX=7227 GN=smo PE=1 SV=1
MQYLNFPRMPNIMMFLEVAILCLWVVADASASSAKFGSTTPASAQQSDVELEPINGTLNYRLYAKKGRDDKPWFDGLDSR
HIQCVRRARCYPTSNATNTCFGSKLPYELSSLDLTDFHTEKELNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKCEKING
EDMVYLPSYEMCRITMEPCRILYNTTFFPKFLRCNETLFPTKCTNGARGMKFNGTGQCLSPLVPTDTSASYYPGIEGCGV
RCKDPLYTDDEHRQIHKLIGWAGSICLLSNLFVVSTFFIDWKNANKYPAVIVFYINLCFLIACVGWLLQFTSGSREDIVC
RKDGTLRHSEPTAGENLSCIVIFVLVYYFLTAGMVWFVFLTYAWHWRAMGHVQDRIDKKGSYFHLVAWSLPLVLTITTMA
FSEVDGNSIVGICFVGYINHSMRAGLLLGPLCGVILIGGYFITRGMVMLFGLKHFANDIKSTSASNKIHLIIMRMGVCAL
LTLVFILVAIACHVTEFRHADEWAQSFRQFIICKISSVFEEKSSCRIENRPSVGVLQLHLLCLFSSGIVMSTWCWTPSSI
ETWKRYIRKKCGKEVVEEVKMPKHKVIAQTWAKRKDFEDKGRLSITLYNTHTDPVGLNFDVNDLNSSETNDISSTWAAYL
PQCVKRRMALTGAATGNSSSHGPRKNSLDSEISVSVRHVSVESRRNSVDSQVSVKIAEMKTKVASRSRGKHGGSSSNRRT
QRRRDYIAAATGKSSRRRESSTSVESQVIALKKTTYPNASHKVGVFAHHSSKKQHNYTSSMKRRTANAGLDPSILNEFLQ
KNGDFIFPFLQNQDMSSSSEEDNSRASQKIQDLNVVVKQQEISEDDHDGIKIEELPNSKQVALENFLKNIKKSNESNSNR
HSRNSARSQSKKSQKRHLKNPAADLDFRKDCVKYRSNDSLSCSSEELDVALDVGSLLNSSFSGISMGKPHSRNSKTSCDV
GIQANPFELVPSYGEDELQQAMRLLNAASRQRTEAANEDFGGTELQGLLGHSHRHQREPTFMSESDKLKMLLLPSK