TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P9WL31|Y2895_MYCTU Uncharacterized protein Rv2895c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2895c PE=1 SV=1
MAGRPLHAFEVVATRHLAPHMVRVVLGGSGFDTFVPSDFTDSYIKLVFVDDDVDVGRLPRPLTLDSFADLPTAKRPPVRT
MTVRHVDAAAREIAVDIVLHGEHGVAGPWAAGAQRGQPIYLMGPGGAYAPDPAADWHLLAGDESAIPAIAAALEALPPDA
IGRAFIEVAGPDDEIGLTAPDAVEVNWVYRGGRADLVPEDRAGDHAPLIEAVTTTAWLPGQVHVFIHGEAQAVMHNLRPY
VRNERGVDAKWASSISGYWRRGRTEEMFRKWKKELAEAEAGTH