TCDB is operated by the Saier Lab Bioinformatics Group
>PAW60084.1 hypothetical protein B9S37_10895 [Verrucomicrobiae bacterium Tous-C3TDCM]
MFTLTLHRLTIIPERKSLATTRKFFIRHHALFCLLLIALSTWPLINWFGKRFNDGGDEPWGLIPLTAAAYFAFRSYQQGT
LHLTRHSARNAVGYLLMLISALSTLHLPPMLRAILALAGISFLFSSRRQSGWLMLLLLSMPALSSAEFYLGWPLRLLVSQ
CSAFLLDLVGLSAQSKGTAILCNNQLVHVDPACSGIRFLWHGILVAAWIATWHETSWMKTLRLVTATTILVILANILRAS
LLILQGIGLIPAGDLLHEFIGLICFALALLPLRFLIPKPNTSIVHIQPKKHNATQCITRYTCLSAAAISSLSLGSLKPWV
GKVYTPSTITLQEFSFQGTTMNVVPCTLTSEEMRFAEHFPGTISVYRSGNTQIILREMNLATRKLHASRDCLRASGYEVS
DAKEVTGAHNNVWLCYRALHDGQRYIVHERITSLVDQSTWTDVSQWFWHALRRPLNGPWRAETIIQREEELP