TCDB is operated by the Saier Lab Bioinformatics Group
>PIU21855.1 hypothetical protein COT15_00180 [Candidatus Diapherotrites archaeon CG08_land_8_20_14_0_20_34_12]
MKNKKVKQKANKKSKPKMLDKKQKKFITVKEIEEKLDSKLKKIIKKENYRRETIKGTIFLVGFLILFGLFSFLINVIPNL
ILQIEIFIANLILAILKAQGLDGSVLLLNELPVIELINGIKIQISYLCTGLMEATVLLAAILASHGIAWRKRIIGALLGI
ALAQIFNITRILLTITFILDSDIQTIEFVHNVFFRVTLFIVIVGIYAAWFWIATRK