TCDB is operated by the Saier Lab Bioinformatics Group
>PLS82034.1 hypothetical protein CYG49_00155 [Candidatus Saccharibacteria bacterium]
MNTLKIIHRVLFIIGLLEISPIHNIAYGQRCTGDYCYNASIFRTIRSSMPTKTLFIISLLSWLLLTMVRAFRVPSTPISA
FELERRVKQHDKEAIALQERERHLPQVRALRFLLEAVLTVLFITLLVTAYGFWVGAFWSMVGLLLLPIFGRTHMVRGGAE
EWYSKNEVKILELAAQLKGPLRFFQQDSELPPVTLHSKEELLFLTQQAKGVLSPNERDLLQHSLQFSELRVEDIMTPRSV
VETVEANETVGALLLDRLHRTGHSRFPIIEGDIDHVVGMLYLHDVISLDKTVQLAREAMQSKVFYIRHDATLDHALHAFL
RTHHHLFVVVNENRETVGIISLEDVIEALLGRKIDDEFDAFSDLRKVAARNPHKINLPPQRQDV