TCDB is operated by the Saier Lab Bioinformatics Group
>PNX46410.1 hypothetical protein BV459_06430 [Thermoplasmata archaeon M11B2D]
MSLKKRLFPQKAVLALILYLIVPLACLLFILESYPELPRELMVARIYWVIPTATAIVILAHLSTLYQKGDMRRFLLSIGF
TVATMIWMFGLLGGGVIITSQWNEYEFSLHMNKYIILIVSVAALNVLYYILEWREYQKDMVSFLTHEEKSQVQLPNR