TCDB is operated by the Saier Lab Bioinformatics Group
>PSG98608.1 hypothetical protein BRC29_00590 [Nanohaloarchaea archaeon SW_7_43_1]
MTGEEDSRIDDLEEKVENIDDRLSRIEDALTGDKEDIGGSLENNFDSSSDSSEERDDSSEDSGMKSPSLESEVGLKWLGR
IGVLAFVLGIAFSIRYAIQQDLIGYTTRIVLGLIAGLGISGLGWFAKEKFSGYERWGRTLMGGGTGIVYFVVYASYHFSG
YQQAIGLTLEQNVFFLAAVALGMFAIAVRENSKVFGAEAVTAGFATAYLGTNIGYYILIYVGLLAGGTALLSYYKNWLAI
HLYAFISTMGIYRIWSEIGGHESGLIFLTSMLALFTASSSAILHKLRELNDLDRVLGLASIYVTPLLFTALATLEFMESG
IEYLYGIYFGIFALQTLVYFVSQNLDVDLENHYLFSGIPFGLTGIFLYFSDFWTTVVYSALAILLVFLSLNLGRKEISYG
GYFVSAVAGSKVLIYDSWRLAGLSYSNPLSSTRLFAYLAVITGFTVIYLLSRLNRDGLRKMNLDYNLVERAFSWSIVLLS
MTAIGLEIEGFRLSVLWGVYGLCLLIMGIKLRLTYFRRQSIAVLGITTFKVFIVDTSGLDTFSRTVSFLVLGILLIASSY
IYTNYSNRIEEAVG