TCDB is operated by the Saier Lab Bioinformatics Group
>PWI49331.1 hypothetical protein CEE45_02010 [Candidatus Heimdallarchaeota archaeon B3_Heim]
MESTQNIEKQYVLKSYILLIVATLIWGGSWPLGRWLVSEELGGETIPPLMIAIVRYFIVIWTFFLLLRWREGTINFSIVT
KHWRPLFLMGLTSVTIYQIGFLYGESYTAASDASLIVATNPIWVFILSGLFLGEGFGRKKAAGVLLAFLGVLLVVGFSPN
ENVPDRFLGDLFILFAALGYSVYTIIYRNYMNGFDAPSDTPSSLFVITWVSFFGFLITTPISLFINPEYLDPLQYLQIPN
RIWLGVAYLSILSTVGAYWFYLEAVKRLNASRAAIFINLVPVWGVSFSVLFIGEFLDPVVHISAFLLISSGIYLANRS