TCDB is operated by the Saier Lab Bioinformatics Group
>PZC86655.1 hypothetical protein B5X24_HaOG206216 [Helicoverpa armigera]
MSRNSSVADSNGELRILLVVTVIIGLLLMFSLLMCYACVLKRLCCGTPRERAKHVGCARRTESYPMGDVTLLSQPTESER
V