TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q00325|MPCP_HUMAN Phosphate carrier protein, mitochondrial precursor (PTP) - Homo sapiens (Human).
MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGLGGIISCGTTH
TALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLW
RTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFER
TVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARII
MIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ