TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q00620 OUTER MEMBRANE PROTEIN NOSA PRECURSOR - Pseudomonas stutzeri (Pseudomonas perfectomarina).
MSSITRGCGARARLSERFSIQPSRLRWQIAHATLLGLLASGALAAESVDHSEHAHHASSAELAPMVITGVAQQSPLTVAT
DPKIPRQPVPASDAGDYLQTIPGFSAVRGGGSNSDPVFRGMFGSRLKLLANGAEMLGACPSRMDSPSSYITPENYDALTV
IKGPQTVLWGPGNSAATILLERDPEDFSELGGRIDASFLVGSDGRFDRNIDAAAGGEQGYIRLLANRSDSDDYQDGNGDD
VHSRWDKWSTDLVLGWTPDEDTLLELTVGRGDGEARYAGRMMDGSQFERESVALRFEKTNLGENLKKIEARVYYNYADHV
MDNYSLRTPPMMQMATNVDRRTLGGRMAATWQLDEYELVTGVDAQTNEHRRRGGVDYKSKPWEKDADFHNYGLFGELTRT
LNDDSRVIGGARLDHATAKDYRSTGPSAGDSRSDNLPSGFLRYEHDLQSLPATAYVGLGHTQRFPDYWELFSGGADAFEK
LDPEKTTQLDFGLQYSKGPLDAWVSAYVGQVRDYILFSYSPSKYSENIDARIMGGELGATYRLTSNWKTDASLAYAWGKN
SSDGEALPQMPPLEGRLGLTYEQGDWSAAGLWRVVAAQNRVAEGKGNVTSKDFDESSGFGVFSLNGAYRVNQNFKLSTGI
DNLFDKAYSEHLNQAGNAGIGLSADERINEPGRTWWARVDMSF