TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q00X06|Q00X06_OSTTA LMBR1 integral membrane protein-like (ISS) OS=Ostreococcus tauri GN=Ot13g01770 PE=4 SV=1
MTDAAAAWLAPLVTVAAVVALVGVRAFADVSVPVVARAHVALAWMLSLAIVFTVPVDVRATVGARAGVPRGLERAWEVMY
WSTYVATFVALPVHASYEDAGDFSTRARLRRAARENGAYLGVMIAACAIGAFAMMATETLSAETMRAYGIVLANVWGYRR
DAVDGFDCVVRWKVSRALRRVTGVSRALTRDRERLASQVKAVATTSGGDAKKTRVAMGDDDNRKRDAGDAEHPRIGSGHY
DYDELSDLVALRRAVRKSMRAYKRTRAQYVIAVEEAFHAEALEQSRMSVARRLHRPPNRGVRSGPLARCLDDLEYTWYIV
VAPILMRCIAVGLAFFSMSIIVAESTIWVGRVWKGADQVSLLSVMLEKAMSDESTSVLNSVQVVVAFPLFYMCFCTFYSL
FKLGMFSFYQLVPRNTDSISLLVNASLWRAKVLACEPIETRGTSSVDWMFNLLIGDDSGARVPLKVPLKAEYADINVGED
VELIVTSDDPDFYTFQAIREAYLPYLDVWVGEYPFLERRGMINVSDRIASGESRESA