TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q012G5|Q012G5_OSTTA Chromosome 09 contig 1, DNA sequence OS=Ostreococcus tauri GN=Ot09g00560 PE=4 SV=1
MPAFTGTMAADVSDAATAFLTALDTSLARAWRDEDREWRKEDRAWRREDLEFRVEERDWWELEHVHRDEQRRWRRQDVEQ
RVLENARWVWGRYTEKNRRDVEEKGEQLRTTSNLSALIAGFAVVALIELQFSDPTTRPDQSEGLIVAFACATAVTVGLML
NSMVLCSFMLSNILRNGKTYVSEDEESEFLYACRKFALHYKPGDTPPTPQRSFERYWETRCESDWRKAFRMFTFGVPMFV
TTLTIATWLKFWYSMVTCVCVTSISIIAVAIWYRTQNVWGAHLLKRSAETFSKSRYFPPEGLPFDWHARPRKAPRSGAKS
PPESATTVGVGAPSAKNRLCKQRDSKASPSIRPFASASSFETLRRAPSKRRLASSPKPISKLHIAFTPIIIHGRARISTH
RDARRRSSAHGPTHREIIHTIVCVDPTSRLVRETSVEFARARSLPPPVVAPRSRTCSRIPERRPRPTARSLARANARTKP
SENYGKKCTARCGT