TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q01674|FOXA_YEREN Ferrioxamine receptor OS=Yersinia enterocolitica GN=foxA PE=3 SV=2
MFSAFIIKRSAILCSLAMFIPLASIADDTIEVTAKAGHEADLPTSGYTATTTKGATKTDQPLILTAQSVSVVTRQQMDDQ
NVATVNQALNYTPGVFTGFSGGATRYDTVALRGFHGGDVNNTFLDGLRLLSDGGSYNVLQVDPWFLERIDVIKGPSSALY
GQSIPGGVVMMTSKRPQFTSEGHFRLTAGNNNTQVAAFDYTDAISEHWAFRLTGITRNSDTMYDHQREERYAIAPSLLWQ
PDENTSLLLRANLQKDPSGGYHSAVPADGSIYGQKLSRGFFDGESNHNVFKRWQQIYSYEFSHKFDDVWSFRQNASYTHS
NTQLEQVYQGGWNSDRTLMNRYYSGEDSSLNAFAVDNQLEADLRTAAVKHKVLLGVDFQKFRNNLRSDSAYATPLNPYTG
VSGGSTLYSDYLLTTPGINTSYLSRRYEQSGVYLQDEMTLDNWHLNLSGRYDRMKTENINNTANSTDERTDNHASGRASL
LYSFDSGISPYVSYSQAITPSLFPDAQQKLLKPMTSEQYEVGIIYQPPGSTSLYSAALYDLTQNDVANRAVPATYYVPAG
KVNSQGLELEARSQISDRLSVIAGYTYNRVKFKDAIDGNDGNTPVLAPSNMASLWAQYEAGYGINVGAGIRYIGKQWADD
ANTLRVPSYTLGDASVRADLGTWAASLKGAFVQLNVNNIADKKYVAACYSTSYCYWGAERSVQATVGYDF