TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q01UI3|Q01UI3_SOLUE Putative uncharacterized protein OS=Solibacter usitatus (strain Ellin6076) GN=Acid_5740 PE=4 SV=1
MENSGESDKFRMLRMLRTSMVAVAMPWLLVCAAGNDEEGAPASARKKSDGQLMLDRSPSELMPGWLRVGGQVRGRFEASS
GSSLVNTAGDAYYLSRIRVDLAFKPAPWLSFAVQAQDGRVGGYNTASASNTIYNPMDFRQGYAELNFEGRATVKLRAGRQ
ELAFGGERLIGPADWGMSRTFDAVDLSLSMGRAKLDLLAGSAVLVDPTRLDRHKPGEHFYGAYGSVKSLLPGLAVEPYLL
FKQNLLIKSENSVTGDAIVASPGLRVSGKLGGRFDYAGEAIVQRGSYSADSVSARAATVLAGWTVSSASWKPRVSAEYNY
ASGDPATRDFNRNTFDQFYPSNHGYYGMIDQFGWKNMKNFRAGFDLVAAKKLKLRGDYNDFRLATVQDSLYNSSGTSAVL
NRKASSDHIDVCGEFLKGRRDRPGGLSPTEAYLRSLIW