TCDB is operated by the Saier Lab Bioinformatics Group
>Q03307|US20_HCMVT Transmembrane protein HWLF3 - Human cytomegalovirus (strain Towne) (HHV-5) (Human herpesvirus 5).
MRVISRARSACTWTSCTSLSPCSTSCPPSPAAPTLLRRRSLPQQRRRPSSSPNRRVRGVTTSPCPTRSLVYKRRVGAPQR
LCAETVATMQAQEANALLLSRMEALEWFKKFTVWLRVYAIFIFQLAFSFGLGSVFWLGFPQNRNFCVENYSFFLTVLVPI
VCMFITYTLGNEHPSNATVLFIYLLANSLTAAIFQMCSESRVLVGSYVMTLALFISFTGLAFLGGRDRRRWKCISCVYVV
MLLSFLTLALLSDADWLQKIVVTLCAFSISFFLGILAYDSLMVIFFCPPNQCIRHAVCLYLDSMAIFLTLLLMLSGPRWI
SLSDGVPLDNGTLTAASTTGKS