TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q04733|CMCT_NOCLA Cephamycin export protein cmcT - Nocardia lactamdurans.
MTSVRGASKTGRTSKTSTATTALVLACTAHFLVVFDTSVITVALPSVRADLGFAPASLQWVVNSYTLAFAGLLLFGGRLA
DIHGHRRVFLGGLAVFTLTSLIGGLATSPASLIAARAGQGAGAAVLAPLAVTMLTTSFAEGPRRTRALTISTAVALVGGA
SGNLLGGVFTEFLSWRSVLLVNVPIGIPVLFLAARVLAGPRKRPWGRVRLDLPGAVLATAGLTLLTLGVSQTHEHGWGEA
AVAVPLAGGLLALLAFVVVEARFAASPLIPPRLFGLPGVGWGNLAMLLAGASQVPVWFFLTLSMQHVLGYSAAQAGLGFV
PHALVMLVVGLRVVPWLMRHVQARVLIAAGAAIGALGFWWQSLLTPDSAYLGGILGPAVLISIGGGLVGTPLARTVTSGV
GPLDAGAASGLMNTTRQFGGAFGLAVLLTVTGSGTSGSPAELASHYGDAFVGIAVFMLAIAVLTPVLPALARSTPPGVIH
VSPVAR