TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q04941|PLP2_HUMAN Proteolipid protein 2 OS=Homo sapiens GN=PLP2 PE=1 SV=1
MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINW
PWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV