TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q04MS6|Q04MS6_STRP2 ABC transporter, ATP-binding protein OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=SPD_0153 PE=3 SV=1
MSRDIIKLDQIDVTFHQKKRTITAVKDVTIHIQEGDIYGIVGYSGAGKSTLVRVINLLQKPSAGKITIDDDVIFDGKVTL
TAEQLRRKRQDIGMIFQHFNLMSQKTAEENVAFALKHSGLSKEEKKAKVAKLLDLVGLADRAENYPSQLSGGQKQRVAIA
RALANDPKILISDESTSALDPKTTKQILALLQDLNQKLGLTVVLITHEMQIVKDIANRVAVMQDGHLIEEGSVLEIFSNP
KQPLTQDFISTATGIDEAMVKIEKQEIVEHLSENSLLVQLKYAGASTDEPLLNELYKHYQVMANILYGNIEILDGTPVGE
LVVVLSGEKAALAGAQEAIRQAGVQLKVLKGVQ