TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q07711 DNA topoisomerase I (EC 5.99.1.2) (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) - Staphylococcus aureus.
MNTLILCEKPSQAMDLSTVFAKKKKQNGYMEISDEQLNVSGFLTWAVGHLVELKEPQEYDEKYKNFSTYPILLEKDDFQF
KVSDKTKDQFNNIKKIFKENKIDEVIIATDPAREGENIAYKILNQLKVTDKVTIKRLWLTSKVESSIRKAFKNILPKEKT
YGFYKEGRARELSDWLVGINLSRHFTKISRELGNDGVIHIGRVSSPTLNMVYNRENNIKGFKGKKFYKVSATINKDEQEV
KTELKNKFDSEDELHEFLFENDITDLTQKGLVTDIEKEIGYTMPPKFYDLSALQEDMNDKYKISAKRTLEIAQTLYEKKL
ITYPRTDSRYITEDEKEMLLENIDYLKEITKINLNNELTNNSLINPSKIEDHYAILITGNDFNKVDLKEEEINVYKSILQ
NVAMNFMDKEQYETTTIEIAVKKLMFEVKGKIIQDNGFKALLNKQKTSEETIPNFEKNEEVDIELDLLEKETTPPKRYTE
KTLLKAMANPIETLEDEGLKSTLKEVKGLGTPATRADIIENLKKNKYIQVQKNKIYITKNGILACLLLEGHLLSKPDLTG
QWEKYLNGISKGEKDDDSFINTINEMIKKTINEEVKNKESIQKVAKEKVSTNNIAKCPACDNGYLIDRKGFYGCTEYNNG
CEFTIPKKLLEKSIPPTVVKALCESKTTKKLKGFKSKKSGKSFDCKLILTKENKLQFSFD