TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q07715 TRSM protein - Staphylococcus aureus.
MINKVIYSGRIATDLKLRKSKNEKSYVFFNIAVPRQFDNDRTDFINCVVWGKQAESLVDYQSKGNLIIIEGSTETYKKDN
INMSRCLVEKTIFLESKKENKKHDVSEDDAISPAEDSGNDKSISDDDLPF