TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q08991|YP279_YEAST UPF0695 membrane protein YPL279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL279C PE=3 SV=1
MIFNPVISNHKLSHYIHVFCTFTTFCILGTETRQAITALSTYTPAFVTAPTVLWSNCSSCMLMGIMQSLNAYTWMKDHQV
LFLGVTTGYCGALSSFSSMLLEMFEHSTNLTNGNIANHTKLPNRAYGIMEFLSVLLVHLMVSMGSLIFGRQLGKEVIVAY
GSSSFSKPYTPPSDTVKENAGDVDTQEMEKNILEFKFKTPAPFFKKFFDVVDKLAYALAFPLIILFVVLCAYYENYSRGK
WTLPCLFGIFAGFLRYWLAEMFNKTNKKFPLGTFLANVFATLLIGIFTMVQRGKKHFSTDIPIVNSLNSCHIVSALISGF
CGTLSTISTFINEGYKLSFINMLIYYTVSIGISYCLLVITLGSYAWTRGLTNPIC