TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q08U57|Q08U57_STIAD Potassium channel protein OS=Stigmatella aurantiaca (strain DW4/3-1) GN=STIAU_1608 PE=4 SV=1
MLESVSQVRTRYGHVLHAAEWCFTLLFAVEYVLRLVAVRRPLDYARSFFGIVDLMALLPSFLSVLFPGAQTLLVVRVLRL
LRVFRILKLGHLLGQAEVLLTALRASRPKITVFLGTVLTIDVIMGAVMYMVEGEENGFDNIPRSMYWAIVTMTTVGFGDI
TPKTVYGQLIASVLMVMGYGIIAVPTGIVSVELAAATRQRPDTQACPGCGTQGHDLDARFCKRCGTALDWKGP