TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q09764|YA7B_SCHPO Hypothetical protein C24H6.11c in chromosome I - Schizosaccharomyces pombe (Fission yeast).
MPTHSLNQKRSLLYPSIDNGSVPDSSFLSQSFRDTNDIHLLSARLASVEVDPETLPSNSPETNDDVSNYDYMSISSYQRA
HSLASTSRNDFNYRPSEINETRPLLPEREEHSSQLPPAQNQVLPFQSLNAPSKKLRGRISLSKIYQFFFDDKGPILFILN
IPAVIIGLLLNILDALSYGLILFPISDPLFKNLGADGLAIYYVSCVVSQLVYSLGGSFFKGSVGSEMIEVIPFFHQIAFT
ILNRVGEDNPKSVIATTILAYCLSSILTGLVFFILGILRLGRLIEFFPRHILLGCIGGVGSFLVLTAVEVSSRLEGSVSF
NWASLSALFQPMTFAKWSIPLFLSSALEFAQQRWPHPFLIPSFFVIAPAIFYVLVWAIPGMSLEYLRETGWVFSSTETNV
PWYHFYSLFSLRDTDWSALLATVPEMCALTFFGILHVPINVPALAISLGLDFVDTDKELIAHGVSNTLSGAVGSIQNYMT
YTNSLMFIRSGGNNRLAGIMLALATVALLVIGPGIIAYIPVWTVGCLIYLLGIELLKESLWDPIGITTKIEYFTICAIVF
TMTVVDFVVGIVIGIIMACVFFVIQASSRSALRGIYSGGIVRSTVRRPMNQQRFLNEIGRQIQVCKLSGFLFFGTINGVE
KNIAGLIEELNVSNNPLRFLIIDFSLVNGADFSVVQAFLRIRRMLATMNVQLCVCGLDETRSSFKTLTTMCFGGDDNCGC
QVFEDVNSSLEYCENMLLDDYDVYRTKLLHKAGYSHTLAVPGKHKQNISMAETFSPSPRHDLLRQVAMSSVKAETKELSK
FEKYAKYEQPFPLLMQVFGEITTKREDFWLGLCPFFKKAFLRKGDLLWRKGDTPSKLVILETGMVKASYQMDRESLSENI
TCLCVVGELPFFSKTCYNATVVAELDSAVWILDREGWETMLKSSDKAEVIENEMLYLTLKMTRDKFNVFTNFALNLYR