TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0BZH6|Q0BZH6_HYPNA Putative membrane protein OS=Hyphomonas neptunium (strain ATCC 15444) GN=HNE_2422 PE=4 SV=1
MGLMPAVDGPEADLAAAGSVSGSRKLDRSAWSWATYQAGRDPYIGLVNGFLFAPYFATLVVGDGVKGQAMIAQMGMISGL
TVAFIAPVIGATVDTIGPRKPWLALITLMVIPLMMSLWFAAPGGAILSPWVVVGILGLISILLSCGEVLFSSMLPYAAAP
RMRPMASGLALSLGNVTSIILLVFILMALMLPEQPLFGLSKENSEPDRMVPILVALTFALCAIPLFLFSKDAAKSGGKAD
ASSVRAGVGSLISLIRNWKQNSDAMIYLLARTLAQDAGGVLLILCGVYAAGVMGWAGTEMLVYGLLGCVAGLIGGVLAGW
LDETFGPRIAFQIEIAGSVIGLIGIIGAAPAQILFMPVADPQPIWNAPMFTTLPELVFVFFGFLGFVFQIAAWSSSRTLL
TRLAPASQMGAFFGLAALAGNSTSWLGPMFVGIFTAVFHSQQAGFIPVAVLFAAGFILLFFVKGGGKEPDLAPD