TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0P7I2|Q0P7I2_LOTJA Sst1 protein OS=Lotus japonicus GN=sst1 PE=2 SV=1
MGTIGNNSHEGDHHGVNFTAQRGFYTKLKSGLKETFFPDDPFRQIKEEENRSRRIIKGVQYYVPIFEWLPNYTLRLFISD
FISGLTITSLAIPQGISYAKLANLPPIVGLYSSFVPPLVYAIFGSSRHMAVGTLAAASLLIGQTISTVASPETDPTLYLH
LIFTTTFVTGVFQACLGIFRLGILVDFFSHSTITGFMGGTAFILIAQQLKGFFGMKHFSTKTNLVEVAKSIITNRHEIRW
ETTVLGLVFLAFLQFTRHVRNKRPKLFWVSAIAPMTVVIVGSIFVYLVHGQKHGIPIVGHLDRGLNPWSIQYFNFDSKYL
PAVMQAALITGVLSLAEGIAIGRSFSVTDNTPHDGNKEMVAFGLMNLFGSFTSCYLTSGPFSKTAVNYNAGGKTAMTNVV
QAVLMALTLQFLAPLFGFTPLVALSAIITSAMLGLVNYTEVIYLYKVDKFDFVICMAAFLGVAFLGMDYGLMISVGLGVI
RALLYVARPATCKLGKLNEFGIYRDVEQYPASTFPGLIIVQLGSPVYFSNSVYVKERVMRYIKSQQRSNEDVVEQVILDM
SGVTSIDTTAIEGLLELNKMLEKNGIEMFLVNPRLEVMEKLIISKFVDKLGKESFYLTLDDAVKASQYSLKKNDNGDIVH
ETSHA