TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q0P885|TUPA_CAMJE Tungstate-binding protein TupA OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=tupA PE=3 SV=1
MKKIISLALALALSASAAELKMATTTSTDNTGLLDALKPLYEKESGNTLKWVAVGTGAALKMGEDCNADVLFVHSPKAEK
EFMKKGFGVDRTPVMYNDFIIIADKSLASKFKGKNLKESLELIKNEKLTFISRGDKSGTDNKEKSLWKNLGGVPEKQSWY
QQSGQGMLASIKIAEEKKGVILTDRGTYIKYEANEKGKPNLVIVNEGDDSLKNFYSVIATNPKHCKNVNYTEASKFIKWV
TSDKTLNFIADFKLLNKPLFVIDAKTRKD