TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q0P886|TUPB_CAMJE Tungstate uptake system permease protein TupB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=tupB PE=1 SV=1
MLKLLILKRIFLDYIFDGFKQALFLLFNADESVISAIKTTLLSSSISIVLALLIGFPLGFILGFFEFKLKRFIKLIVDTS
LSFPTVAVGLILYALISSRGPLGEFGLLFTIKALILGQFILALPIVIALFSNLIENMNKKHFLLIKSFHLSPLKLVLTMI
YELRFALISVVALAYGRIVAEVGVAMIVGGNIKYDTRTITTAISLETNKGEFASGIALALVLILIAFCLNFITHKLKRT