TCDB is operated by the Saier Lab Bioinformatics Group
>Q0RI11|Q0RI11_FRAAA Putative uncharacterized protein - Frankia alni (strain ACN14a).
MTQTIPPGWYADPSGQHGSRWWDGSQWTEHTQPPPGQGGGYGQGGEYGPGGQIGQYGQDQAAAVPGQAWGAPLGVQPGAV
YTKHSAEQVQRQVQEQAGVQPAGPGGGTLFSEPVLVVNQKSKIIEVTNEYAVFDQGGKQIGSVVEVGQSALKKAARVLTS
WDQFFSHRLEVRDAAGTVQLLLHRPAKVFKSKVIVSLPDGSELGVIAQQNVFGKIRFDLQAGGTTIGAIKAENWRAWNFS
IVDQNDVEVARVTKTWEGLARAMFTTADNYVVQLHRPLPQPLHSMVVAAALTIDTALKQDSRGLG