TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0VQY5|Q0VQY5_ALCBS Multidrug/solvent RND membrane fusion protein, putative OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=ABO_0965 PE=4 SV=1
MYILNLIHFSCKHHKPSLMDKLMACYSVFPSTEVIMRSGFILPLIAGVLALQLSGCGDAGQSGQQQQQQAPEVGFVTVKA
ATVTLNRELPGRTTAHQVAEVRPQVSGVIEKRLFEEGQEVSAGQPLYKIDSRTYQAAVASARAELARATATLNSNDLRAK
RFKKLLDYKAVSQQEYDEAQAQLDENKAAVAAARANLQSAQINLDYATIKAPISGRIGRSSVTAGALVTANQANALATIR
QLDPIYVDLTQSSNELRQLRQAMQAGELQQVSDDEARITLILEDGSHYKEAGALQFSEFAVDESTGSVTLRALFPNPDGE
LLPGMFVRGRLPEGQRKDAILVPQKGITRDPTGQAYAMLIDDNNQVKKVKVRTERAVGNQWLIADGLKDGDRLIVDGLQR
IQPGAPVSPVDTEKANVEPAPAQQEQPQSPASDAGEAQSAAQ